LL-37

En termes simples

LL-37 est le seul peptide de sa famille que l'organisme humain produit lui-même pour se défendre contre les microbes. On l'étudie comme moyen de lutte contre les bactéries résistantes et pour la cicatrisation des plaies chroniques.

Qu'est-ce que cette molécule

[LL-37, 37 aa] — 37 aa. α-hélicoïdal. Fragment C-terminal de hCAP18. La seule cathélicidine humaine. ~4493 Da.

Pourquoi on l'étudie

Peptide antimicrobien + immunomodulateur clé de l'immunité innée. Actif contre MRSA, MSSA. ↓Biofilms des plaies chroniques. ↑Cicatrisation des plaies (↑angiogenèse, ↑épithélialisation). Prometteur dans l'acné, la rosacée, les plaies chroniques, le sepsis.

Comment ça marche

Hélice α amphipathique → interaction électrostatique avec la membrane bactérienne → formation de pores → lyse. Immunomodulation : ↑chimiotactisme des neutrophiles/DC, ↓NLRP3/caspase-1/GSDMD (pyroptose). ↑Migration des cellules cutanées → ↑épithélialisation.

Doses dans les études

Les études ont utilisé par voie topique 5-10 mg dans une crème/un gel ; par voie systémique (Research) — 0.5-1 mg SC dans la zone atteinte 2-3 fois/semaine.

Associations étudiées

• GHK-Cu — régénération + antimicrobien
• BPC-157 — récupération en profondeur
• Defensins — immunité innée conjointement

Niveau de preuve

Niveau C Études chez l'animal. Les effets ont été montrés chez l'animal. Leur transposition à l'humain n'est pas prouvée. animaux + in vitro. Potentiel clinique élevé.

À savoir

⚠️ Dégradé par les protéases cutanées (T½ courte). Aucun ECR achevé. Research only.

Études dans PubMed

1. LL-37 improves sepsis-induced acute lung injury by suppressing pyroptosis in alveolar epithelial cells. (Int Immunopharmacol, 2024)
2. The human cathelicidin peptide LL-37 inhibits pancreatic cancer growth by suppressing autophagy and reprogramming of the tumor immune microenvironment. (Front Pharmacol, 2022)
3. The Potential of Human Peptide LL-37 as an Antimicrobial and Anti-Biofilm Agent. (Antibiotics (Basel), 2021)
4. Efficacy of antimicrobial peptide LL-37 against biofilm forming Staphylococcus aureus strains obtained from chronic wound infections. (Microb Pathog, 2022)
5. Therapeutic Potential of Cathelicidin Peptide LL-37, an Antimicrobial Agent, in a Murine Sepsis Model. (Int J Mol Sci, 2020)